PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID EPS74412.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Lentibulariaceae; Genlisea
Family CAMTA
Protein Properties Length: 126aa    MW: 15470.5 Da    PI: 10.2045
Description CAMTA family protein
Gene Model
Gene Model ID Type Source Coding Sequence
EPS74412.1genomeLSMUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1CG-1182.25.9e-5761222118
        CG-1   2 lkekkrwlkneeiaaiLenfekheltlelktrpksgsliLynrkkvryfrkDGyswkkkkdgktvrEdhekLKvggvevlycyYahseenptfqrrcyw 100
                 l+ ++rwl++ ei +iLenf++++++ e+++rp+sgs++L++rk+ ryfr+DG++w+kk+dgktv+E+he+LKvg+v+vl+cyYah+e+n+ fqrr+yw
  EPS74412.1   6 LEAQNRWLRPAEISRILENFQNFQIAREPPNRPPSGSVFLFDRKQHRYFRRDGHNWRKKRDGKTVKEAHERLKVGSVDVLHCYYAHGEDNECFQRRSYW 104
                 5679*********************************************************************************************** PP

        CG-1 101 lLeeelekivlvhylevk 118
                 lL+ee+++iv+vhy+++k
  EPS74412.1 105 LLDEERSNIVFVHYRDTK 122
                 ***************985 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5143775.7281126IPR005559CG-1 DNA-binding domain
SMARTSM010761.5E-744122IPR005559CG-1 DNA-binding domain
PfamPF038593.2E-507120IPR005559CG-1 DNA-binding domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 126 aa     Download sequence    Send to blast
IHRILLEAQN RWLRPAEISR ILENFQNFQI AREPPNRPPS GSVFLFDRKQ HRYFRRDGHN  60
WRKKRDGKTV KEAHERLKVG SVDVLHCYYA HGEDNECFQR RSYWLLDEER SNIVFVHYRD  120
TKYMKQ
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009385632.12e-67PREDICTED: calmodulin-binding transcription activator 2-like
RefseqXP_009385633.12e-67PREDICTED: calmodulin-binding transcription activator 2-like
RefseqXP_009385634.12e-67PREDICTED: calmodulin-binding transcription activator 2-like
RefseqXP_009385635.12e-67PREDICTED: calmodulin-binding transcription activator 2-like
RefseqXP_009385636.12e-67PREDICTED: calmodulin-binding transcription activator 2-like
SwissprotQ6NPP44e-62CMTA2_ARATH; Calmodulin-binding transcription activator 2
TrEMBLS8ENI93e-91S8ENI9_9LAMI; Calmodulin-binding protein (Fragment)
STRINGGSMUA_AchrUn_randomP02100_0012e-66(Musa acuminata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA14489811
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G64220.22e-63Calmodulin-binding transcription activator protein with CG-1 and Ankyrin domains
Publications ? help Back to Top
  1. Leushkin EV, et al.
    The miniature genome of a carnivorous plant Genlisea aurea contains a low number of genes and short non-coding sequences.
    BMC Genomics, 2013. 14: p. 476
    [PMID:23855885]